Skip to product information
1 of 1

Gene Bio Systems

Recombinant Cytochrome b6-f complex iron-sulfur subunit 2, cyanelle(petC-2)

Recombinant Cytochrome b6-f complex iron-sulfur subunit 2, cyanelle(petC-2)

SKU:CSB-CF704730DZX

Regular price €1.461,95 EUR
Regular price Sale price €1.461,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Cyanophora paradoxa

Uniprot NO.:Q5CC92

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:CSAASDEVPDMGKRKLMNLLLLGAIAGPTIGAGGPFVSFLVPPKSGGGAGAGQAAKDAAG NDIKVEKWLETXKPGDRSLAQGLKGDATYLIVKEDGTLEKYGLNAVCTHLGCVVPWNQSE GKFMCPCHGSQYDRTGKVVRGPAPLSLALAHVNVLEDGVVAFEPWTETDFRTNTAPWWK

Protein Names:Recommended name: Cytochrome b6-f complex iron-sulfur subunit 2, cyanelle EC= 1.10.9.1 Alternative name(s): Plastohydroquinone:plastocyanin oxidoreductase iron-sulfur protein 2 Rieske iron-sulfur protein 2 Short name= ISP 2 S

Gene Names:Name:petC-2

Expression Region:63-241

Sequence Info:full length protein

View full details