
Size: 200ug. Other sizes are also available. Please Inquire.
In Stock: No
Lead time: 10-20 working days
Research Topic: Allergen
Uniprot ID: O04725
Gene Names: PRO1
Organism: Cynodon dactylon (Bermuda grass) (Panicum dactylon)
AA Sequence: SWQAYVDDHLMCEIEGHHLTSAAIIGHDGTVWAQSAAFPAFKPEEMANIMKDFDEPGFLAPTGLFLGPTKYMVIQGEPGAVIRGKKGSGGVTVKKTGQALVIGIYDEPMTPGQCNMVIEKLGDYLIEQGM
Expression Region: 2-131aa
Sequence Info: Full Length
Source: E.coli
Tag Info: N-terminal 6xHis-SUMO-tagged
MW: 30 kDa
Alternative Name(s): Pollen allergen Cyn d 12 Allergen: Cyn d 12
Relevance: Binds to actin and affects the structure of the cytoskeleton. At high concentrations, profilin prevents the polymerization of actin, whereas it enhances it at low concentrations. By binding to PIP2, it inhibits the formation of IP3 and DG
Reference: "Cloning and high level expression of Cynodon dactylon (Bermuda grass) pollen profilin (Cyn d 12) in Escherichia coli: purification and characterization of the allergen."Asturias J.A., Arilla M.C., Gomez-Bayon N., Martinez J., Martinez A., Palacios R.Clin. Exp. Allergy 27:1307-1313(1997)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer,50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
You may also like
-
Rabbit Anti-Human Actinin-?2/3 Polyclonal Antibody
- Regular price
- €398,95 EUR
- Sale price
- €398,95 EUR
- Regular price
-
- Unit price
- per
Sold out -
Rabbit Anti-Human Catenin-? Polyclonal Antibody
- Regular price
- €398,95 EUR
- Sale price
- €398,95 EUR
- Regular price
-
- Unit price
- per
Sold out -
Rabbit Anti-Human p53 (Acetyl Lys320) Polyclonal Antibody
- Regular price
- €398,95 EUR
- Sale price
- €398,95 EUR
- Regular price
-
- Unit price
- per
Sold out -
Rabbit anti-human Cyclin-dependent kinase inhibitor 1 (CDKN1A) PolyClonal antibody
- Regular price
- €398,95 EUR
- Sale price
- €398,95 EUR
- Regular price
-
- Unit price
- per
Sold out