Recombinant Cyanothece sp.  NAD(P)H-quinone oxidoreductase subunit 3

Recombinant Cyanothece sp. NAD(P)H-quinone oxidoreductase subunit 3

CSB-CF541620DZY
Regular price
€1.014,95 EUR
Sale price
€1.014,95 EUR
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Cyanothece sp. (strain ATCC 51142)

Uniprot NO.:B1WZG2

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MFVLNGYEYVLGFLLACSLIPILALTASKILRPSGGGPERRTTYESGMEPIGGAWIQFNI RYYMFALVFVVFDVETVFLYPWAVAFSRLGLLAFVEALIFIAILVVALVYAWRKGALEWS

Protein Names:Recommended name: NAD(P)H-quinone oxidoreductase subunit 3 EC= 1.6.5.- Alternative name(s): NAD(P)H dehydrogenase subunit 3 NADH-plastoquinone oxidoreductase subunit 3 NDH-1 subunit 3 Short name= NDH-C

Gene Names:Name:ndhC Ordered Locus Names:cce_1764

Expression Region:1-120

Sequence Info:full length protein

Your list is ready to share