Gene Bio Systems
Recombinant Cyanothece sp. Cytochrome b6-f complex subunit 4(petD)
Recombinant Cyanothece sp. Cytochrome b6-f complex subunit 4(petD)
SKU:CSB-CF493318EPV
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Cyanothece sp. (strain PCC 7425 / ATCC 29141)
Uniprot NO.:B8HWC7
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MAKVQKKPDLSDPKLKAMLKKGMGHNYYGEPAWPNDLLYIFPVVILGSIALCVGLAVLDP AMVGEPADPFATPLEILPEWYLYPVFQILRVVPNKLLGVVLMGSIPLGLMLVPFIENVNK FQNPFRRPVATTVFLFGTLFTLWLGIGATFPIDKSFTLGLF
Protein Names:Recommended name: Cytochrome b6-f complex subunit 4 Alternative name(s): 17 kDa polypeptide
Gene Names:Name:petD Ordered Locus Names:Cyan7425_2348
Expression Region:1-161
Sequence Info:full length protein
