Gene Bio Systems
Recombinant Cyanothece sp. Cytochrome b559 subunit alpha(psbE)
Recombinant Cyanothece sp. Cytochrome b559 subunit alpha(psbE)
SKU:CSB-CF472550EPW
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Cyanothece sp. (strain PCC 8801) (Synechococcus sp. (strain PCC 8801 / RF-1))
Uniprot NO.:B7K626
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MSGSTGERPFSDIVTSIRYWVIHSITIPMLFIAGWLFVSTGLAYDVFGTPRPDQYFTQER QELPIISDRYKASQQIQEFNK
Protein Names:Recommended name: Cytochrome b559 subunit alpha Alternative name(s): PSII reaction center subunit V
Gene Names:Name:psbE Ordered Locus Names:PCC8801_4147
Expression Region:1-81
Sequence Info:full length protein
