Skip to product information
1 of 1

Gene Bio Systems

Recombinant Cyanidioschyzon merolae ATP synthase subunit b', chloroplastic(atpG)

Recombinant Cyanidioschyzon merolae ATP synthase subunit b', chloroplastic(atpG)

SKU:CSB-CF771215DZU

Regular price €1.425,95 EUR
Regular price Sale price €1.425,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Cyanidioschyzon merolae (Red alga)

Uniprot NO.:Q85FR1

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MSTGLFDFNGTLPVMGLQVVLLSWLLEQILYSPIQGVIQKRQNKIQQELQLAADQLQKAQ QLTQEYQTQLQKAREKARERIRQVQQEAQTMMEDQLKQAQQQMTQLFNEAMQQLEQQKQQ ALMNLSNQVDEVAKFILSKLMKQ

Protein Names:Recommended name: ATP synthase subunit b', chloroplastic Alternative name(s): ATP synthase F(0) sector subunit b' ATPase subunit II

Gene Names:Name:atpG

Expression Region:1-143

Sequence Info:full length protein

View full details