Gene Bio Systems
Recombinant Cuscuta obtusiflora ATP synthase subunit C, plastid(atpE)
Recombinant Cuscuta obtusiflora ATP synthase subunit C, plastid(atpE)
SKU:CSB-CF428899CXS
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Cuscuta obtusiflora (Peruvian dodder)
Uniprot NO.:A8W3H7
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MNPIISAASVIAAGFAVGLASIGPGIGQGTAAGRAVEGIARQPEAEGKIRGTLLLSLAFM EALTIYGLVVALALLFANPFI
Protein Names:Recommended name: ATP synthase subunit C, plastid Alternative name(s): ATP synthase F0 sector subunit C ATPase subunit III Lipid-binding protein
Gene Names:Name:atpE Synonyms:atpH
Expression Region:1-81
Sequence Info:full length protein
