Recombinant Crotalus viridis viridis Cytochrome b(MT-CYB)

CSB-CF853273DYG

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Crotalus viridis viridis (Prairie rattlesnake)

Uniprot NO.:Q95776

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MTHQHLLTMFNLLPVGXNISTWWNFGSMLLSCLTIQIITGFFLAIHYTANINMAFSSIMH ISRDVPYGWIMQNTHAIGXSLFFICIYIHIARGIYYGSYLNKEVWLSGTTLLITLMATAS XXMCYHDT

Protein Names:Recommended name: Cytochrome b Alternative name(s): Complex III subunit 3 Complex III subunit III Cytochrome b-c1 complex subunit 3 Ubiquinol-cytochrome-c reductase complex cytochrome b subunit

Gene Names:Name:MT-CYB Synonyms:COB, CYTB, MTCYB

Expression Region:1-128

Sequence Info:full length protein