Recombinant Crotalus adamanteus Zinc metalloproteinase adamalysin-2

Customer Reviews

Be the first to write a review
0%
(0)
0%
(0)
0%
(0)
0%
(0)
0%
(0)

Recombinant Crotalus adamanteus Zinc metalloproteinase adamalysin-2

CSB-EP330325DYB
Regular price
€917,95 EUR
Sale price
€917,95 EUR
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.
 More payment options

>Several Other Sizes Are Also Available. Please Inquire. Default Size: 200ug

Updated Date: Stock Protein updated on 20170725

Research areas: others

Target / Protein:

Biologically active: Not Tested

Expression system: E.coli

Species of origin: Crotalus adamanteus (Eastern diamondback rattlesnake)

Delivery time: 3-7 business days

Uniprot ID: P34179

AA Sequence: QQNLPQRYIELVVVADRRVFMKYNSDLNIIRTRVHEIVNIINGFYRSLNIDVSLVNLEIWSGQDPLTIQSSSSNTLNSEGLWREKVLLNKKKKDNAQLLTAIEFKCETLGKAYLNSMCNPRSSVGIVKDHSPINLLVAVTMAHELGHNLGMEHDGKDCLRGASLCIMRPGLTPGRSYEFSDDSMGYYQKFLNQYKPQCILNKP

Tag info: N-terminal 6xHis-tagged

Expression Region: 1-203aa

Protein length: Full Length

MW: 27.1 kDa

Alternative Name(s): Adamalysin II Proteinase II

Relevance: Has no significant hemorrhagic activity, but inactivates serpins by limited proteolysis of their reactive-site loops.

Reference: "First structure of a snake venom metalloproteinase: a prototype for matrix metalloproteinases/collagenases." Gomis-Rueth F.-X., Kress L.F., Bode W. EMBO J. 12:4151-4157(1993)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

You may also like

  • Recombinant Crotalus adamanteus Snake venom metalloproteinase adamalysin-2
    Regular price
    €917,95 EUR
    Sale price
    €917,95 EUR
    Regular price
    Unit price
    per 
    Sold out
  • Recombinant Crotalus adamanteus Thrombin-like enzyme crotalase(SVTLE)
    Regular price
    €917,95 EUR
    Sale price
    €917,95 EUR
    Regular price
    Unit price
    per 
    Sold out
  • Recombinant Crotalus adamanteus Thrombin-like enzyme crotalase
    Regular price
    €1.006,95 EUR
    Sale price
    €1.006,95 EUR
    Regular price
    Unit price
    per 
    Sold out
  • Recombinant Human COP9 signalosome complex subunit 2(COPS2)
    Regular price
    €886,95 EUR
    Sale price
    €886,95 EUR
    Regular price
    Unit price
    per 
    Sold out

Your list is ready to share