Skip to product information
1 of 1

Gene Bio Systems

Recombinant Coxiella burnetii Uncharacterized protein CBU_1413(CBU_1413)

Recombinant Coxiella burnetii Uncharacterized protein CBU_1413(CBU_1413)

SKU:CSB-CF767807DXP

Regular price €1.516,95 EUR
Regular price Sale price €1.516,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Coxiella burnetii (strain RSA 493 / Nine Mile phase I)

Uniprot NO.:Q83BT9

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:GGPEIPPSAPWVIYLGGFGGIYVANFEYQGTYLGGSFTVPIGSNVHQNGYTAGGHIGLRY YFSNPWFLGLEFAAMGNSENATTAESVLAPSPDDLIFNLVNQFRIKSNLDLTAQLGVNIT PQTRVYIKGGASYARIRHILTVFNPATLTPTISLQRTTHKNRWGFLVGFGLGYDFCPWFG IFTEYNYYDYGRVGLDSLSNIRPNNGADTYHQNVRVHAYSVLLGVNLNFSV

Protein Names:Recommended name: Uncharacterized protein CBU_1413

Gene Names:Ordered Locus Names:CBU_1413

Expression Region:29-259

Sequence Info:full length protein

View full details