Gene Bio Systems
Recombinant Corynebacterium glutamicum UPF0233 membrane protein cgR_0053 (cgR_0053)
Recombinant Corynebacterium glutamicum UPF0233 membrane protein cgR_0053 (cgR_0053)
SKU:CSB-CF391373CXG
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Corynebacterium glutamicum (strain R)
Uniprot NO.:A4Q9X1
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MPKARVTKNETAPVSSNPSANRTPVKINSAGTPMWYKVIMFAFMIVGLAWLIVNYLVGPQ IPFMADLGAWNYGIGFGLMIIGLLMTMGWR
Protein Names:Recommended name: UPF0233 membrane protein cgR_0053
Gene Names:Ordered Locus Names:cgR_0053
Expression Region:1-90
Sequence Info:full length protein
