Skip to product information
1 of 1

Gene Bio Systems

Recombinant Corynebacterium glutamicum Menaquinol-cytochrome c reductase cytochrome c subunit(qcrC)

Recombinant Corynebacterium glutamicum Menaquinol-cytochrome c reductase cytochrome c subunit(qcrC)

SKU:CSB-CF844114DWY

Regular price €1.567,95 EUR
Regular price Sale price €1.567,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025)

Uniprot NO.:Q8NNK5

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MAKPSAKKVKNRRKVRRTVAGALALTIGLSGAGILATAITPDAQVATAQRDDQALISEGK DLYDVACITCHGVNLQGVEDRGPSLVGVGEGAVYFQVHSGRMPILRNEAQAERKAPRYTE AQTLAIAAYVAANGGGPGLVYNEDGTLAMEELRGENYDGQITSADVARGGDLFRLNCASC HNFTGRGGALSSGKYAPNLDAANEQEIYQAMLTGPQNMPKFSDRQLSADEKKDIIAFIKS TKETPSPGGYSLGSLGPVAEGLFMWVFGILVLVAAAMWIGSRS

Protein Names:Recommended name: Menaquinol-cytochrome c reductase cytochrome c subunit Alternative name(s): Cytochrome bc1 complex cytochrome c subunit Short name= Cytochrome cc

Gene Names:Name:qcrC Ordered Locus Names:Cgl2191, cg2405

Expression Region:1-283

Sequence Info:full length protein

View full details