
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Coccidioides immitis (strain RS) (Valley fever fungus)
Uniprot NO.:Q1DZS0
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MPSLLIIVLIIHVVTYLINTIGANTIDSLLWLLYLKLPNQTSQTANEQRRLKREVMQLKR EMNATSSQDEFAKWAKLRRRHDKTMEEYEAKNKALGKHKSSFDLAVKSIRFFSTTGLKLF LQFWCSKTPIFELPRGWIPWQVEWVLSFPRAPLGTVSIQIWGGVCATVVSLAGDAIGVVN VYLTSKAPKQKEPATSGENSARPMAIKKEL
Protein Names:Recommended name: Protein GET1 Alternative name(s): Guided entry of tail-anchored proteins 1
Gene Names:Name:GET1 ORF Names:CIMG_04193
Expression Region:1-210
Sequence Info:full length protein
You may also like
-
Recombinant Coccidioides posadasii Protein GET1(GET1)
- Regular price
- €1.093,95 EUR
- Sale price
- €1.093,95 EUR
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Coccidioides immitis Assembly factor CBP4(CBP4)
- Regular price
- €1.019,95 EUR
- Sale price
- €1.019,95 EUR
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Coccidioides immitis Cytochrome c oxidase assembly protein COX16, mitochondrial(COX16)
- Regular price
- €1.030,95 EUR
- Sale price
- €1.030,95 EUR
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Coccidioides immitis Mitochondrial thiamine pyrophosphate carrier 1(TPC1)
- Regular price
- €1.173,95 EUR
- Sale price
- €1.173,95 EUR
- Regular price
-
- Unit price
- per
Sold out