Recombinant Coccidioides immitis  Cytochrome c oxidase assembly protein COX16, mitochondrial(COX16)

Recombinant Coccidioides immitis Cytochrome c oxidase assembly protein COX16, mitochondrial(COX16)

CSB-CF625595DUV
Regular price
€1.017,95 EUR
Sale price
€1.017,95 EUR
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Coccidioides immitis (strain RS) (Valley fever fungus)

Uniprot NO.:Q1DME3

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:STSAGSTLGDRIGQMYRAHLSKHPFLLFGLPFLSLMVAGSFVLTPATALRYERHDRKVQQ VSQQEALALGIKGPDGDGENDIKMNPRRRVLGSEKEEYYRLMAKDLDNWEQKRVQRWKGE PDGRLS

Protein Names:Recommended name: Cytochrome c oxidase assembly protein COX16, mitochondrial

Gene Names:Name:COX16 ORF Names:CIMG_08520

Expression Region:12-137

Sequence Info:full length protein

Your list is ready to share