Gene Bio Systems
Recombinant Clostridium novyi UPF0756 membrane protein NT01CX_1209 (NT01CX_1209)
Recombinant Clostridium novyi UPF0756 membrane protein NT01CX_1209 (NT01CX_1209)
SKU:CSB-CF369538CWY
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Clostridium novyi (strain NT)
Uniprot NO.:A0PY40
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MSSKIILLILMFLSFISKNKSLGIATIVMLFISFFNTEKCITFMENHFMNLGMTFLMIWM LIPIIKNPEFTENIKNAFNLKGIVCFLCGAIVAVLASKGVGFLKGSTDTLTGIILGSIVG VSLLGGVPVGPLIASGIAYEVVFIINLIFKNNC
Protein Names:Recommended name: UPF0756 membrane protein NT01CX_1209
Gene Names:Ordered Locus Names:NT01CX_1209
Expression Region:1-153
Sequence Info:full length protein
