Skip to product information
1 of 1

Gene Bio Systems

Recombinant Clostridium beijerinckii Putative AgrB-like protein(cfg02)

Recombinant Clostridium beijerinckii Putative AgrB-like protein(cfg02)

SKU:CSB-CF773695CLP

Regular price €1.483,95 EUR
Regular price Sale price €1.483,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Clostridium beijerinckii (Clostridium MP)

Uniprot NO.:Q7WYU3

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MIKYLSTNISLYFQENNSCLSKKDVLKIQYTLEAILSDLSKFIIIFLVFLFIKEIPLFLF SFIILNSTRPLLGGIHCKTYYGCLTCSILYFMIILLFTRLFPELNTNFYIVFFILSLAIT FIFAPCPNEKRPVKNKATLKILSLISLTFWIILFYLSPLQTRNCILISIFLQIIQVIIIN TKGVIFNAKNNKTFFNRTT

Protein Names:Recommended name: Putative AgrB-like protein EC= 3.4.-.-

Gene Names:Name:cfg02

Expression Region:1-199

Sequence Info:full length protein

View full details