Skip to product information
1 of 1

Gene Bio Systems

Recombinant Chlamydomonas reinhardtii Photosystem I reaction center subunit psaK, chloroplastic(PSAK)

Recombinant Chlamydomonas reinhardtii Photosystem I reaction center subunit psaK, chloroplastic(PSAK)

SKU:CSB-CF320342DSJ

Regular price €1.373,95 EUR
Regular price Sale price €1.373,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Chlamydomonas reinhardtii (Chlamydomonas smithii)

Uniprot NO.:P14225

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:DGFIGSSTNLIMVASTTATLAAARFGLAPTVKKNTTAGLKLVDSKNSAGVISNDPAGFTI VDVLAMGAAGHGLGVGIVLGLKGIGAL

Protein Names:Recommended name: Photosystem I reaction center subunit psaK, chloroplastic Alternative name(s): Light-harvesting complex I 8.4 kDa protein P37 protein PSI-K Photosystem I subunit X

Gene Names:Name:PSAK

Expression Region:27-113

Sequence Info:full length protein

View full details