Gene Bio Systems
Recombinant Chlamydia muridarum Sulfur-rich protein(srp)
Recombinant Chlamydia muridarum Sulfur-rich protein(srp)
SKU:CSB-CF865396CIU
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Chlamydia muridarum (strain MoPn / Nigg)
Uniprot NO.:Q9PJV1
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MSTTPIVSGVTSQNNSSENVSNNARSLTLKERASKILSSTAFKVGLAVVGIFLVILSIVL LFILPATAASNPIYLAIPAILGCVNICIGILSMNKGSCSEAKWKLCKNVLKTSEDILDDG ELNNSNKIFTDDNLSRVEDIVITLSSRRNSVA
Protein Names:Recommended name: Sulfur-rich protein Alternative name(s): Cysteine-rich protein A
Gene Names:Name:srp Synonyms:crpA Ordered Locus Names:TC_0726
Expression Region:1-152
Sequence Info:full length protein
