Skip to product information
1 of 1

Gene Bio Systems

Recombinant Chicken ATP synthase subunit a(MT-ATP6)

Recombinant Chicken ATP synthase subunit a(MT-ATP6)

SKU:CSB-CF015070CH

Regular price €1.503,95 EUR
Regular price Sale price €1.503,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Gallus gallus (Chicken)

Uniprot NO.:P14092

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MNLSFFDQFSSPCLLGIPLILPSLLLPALLLPSPGNRWINNRLSTIQLWFTHLITKQLMT PLNKAGHKWALLLTSLILMLLSINLLGLLPYTFTPTTQLSMNMALALPLWLATLLTGLRN QPSASLGHLLPEGTPTPLIPALIMIETTSLLIRPLALGVRLTANLTAGHLLIQLISTATI ALLPMMPSISALTALILFLLTILEVAVAMIQAYVFVLLLSLYLQENI

Protein Names:Recommended name: ATP synthase subunit a Alternative name(s): F-ATPase protein 6

Gene Names:Name:MT-ATP6 Synonyms:ATP6, ATPASE6, MTATP6

Expression Region:1-227

Sequence Info:Full length protein

View full details