Skip to product information
1 of 1

Gene Bio Systems

Recombinant Chaetomium globosum Protein GET1(GET1)

Recombinant Chaetomium globosum Protein GET1(GET1)

SKU:CSB-CF644111CHI

Regular price €1.495,95 EUR
Regular price Sale price €1.495,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) (Soil fungus)

Uniprot NO.:Q2GNR9

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MPSLLVVVFVIELVVQLVNTIGATTINNLIWRAYLSIPTSLAKQFTEQRQKQKEYLAVRL ELNATSSQDEFAKWAKLRRQHDKLLDELEKKKSAVEASRTKFDRYITAVRFISTRGVQWL LPMWYGKLPMFWLPYGWFPYYVEWFVSFPRAPLGSVSIVTWQAACTAILTLVMNAVVGIL AFISASRQSGKQKQKQPVPAAGARNGETKKEL

Protein Names:Recommended name: Protein GET1 Alternative name(s): Guided entry of tail-anchored proteins 1

Gene Names:Name:GET1 ORF Names:CHGG_10385

Expression Region:1-212

Sequence Info:full length protein

View full details