Recombinant Centruroides suffusus suffusus Beta-mammal toxin Css4

SKU: CSB-YP350214DRC

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 22-32 working days

Research Topic: Others

Uniprot ID: P60266

Gene Names: N/A

Organism: Centruroides suffusus suffusus (Mexican scorpion)

AA Sequence: KEGYLVNSYTGCKFECFKLGDNDYCLRECRQQYGKGSGGYCYAFGCWCTHLYEQAVVWPLPNKTCN

Expression Region: 1-66aa

Sequence Info: Full Length

Source: Yeast

Tag Info: N-terminal 6xHis-tagged

MW: 9.6 kDa

Alternative Name(s): Css IV

Relevance: Beta toxins bind voltage-independently at site-4 of sodium channels (Nav) and shift the voltage of activation toward more negative potentials thereby affecting sodium channel activation and promoting spontaneous and repetitive firing. This toxin is active only on mammals.

Reference: "Purification and chemical and biological characterizations of seven toxins from the Mexican scorpion, Centruroides suffusus suffusu.Martin M.-F., Garcia Y., Perez L.G., el Ayeb M., Kopeyan C., Bechis G., Jover E., Rochat H.J. Biol. Chem. 262:4452-4459(1987)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer，50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.