Skip to product information
1 of 1

Gene Bio Systems

Recombinant Cenarchaeum symbiosum DNA polymerase II large subunit(polC),partial

Recombinant Cenarchaeum symbiosum DNA polymerase II large subunit(polC),partial

SKU:CSB-EP370095DRA

Regular price €868,95 EUR
Regular price Sale price €868,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: Yes

Lead time: 3-7 working days

Research Topic: Others

Uniprot ID: A0RYM0

Gene Names: polC

Organism: Cenarchaeum symbiosum (strain A)

AA Sequence: LAELKGAVQTGENKEDAAAKRMREVITGRSVLSMPNRLGGFRLRYGRACNTGYTSVGFHPAVAEILDHTIAVGTQVKIDIPGKGATVAFVDTIEAPTVRLAGGDVVKIRDVAHGIELKGSIERILHLGDMLISFGDFLENNAQLVPSGYVEEIWKMDMEAAGAAQGSPSSADEAVRISRELGVPLHPRYLYYWDQISHEELAMLLSPLDKGDAISYPAACKPVLEKLGVPHKAGPEGPVLEGDEARIFRELILDNPPGPDASAPVPELISRSSGITIRDKFSTSIGVRIGRPEKAAPRQMRPPTHCLFPVGGTGGPTNNLLKSAARPGFSADILSRRCPGCGEPSISIRCWACGERTAVERTCMQCGTDVDGEECERCGRPGLAHSRVEFPLKKMLVSAQEKTGVRAHDPLKGVKELAHQDRIAEPLEKGLIRQSRSLTVFKDGTVRFDATNSPMTHFKPSWIGTSAEKLRELGYETDVDGKKLEGPDQLVELRMQDIVIPLEGAKYLVSACGYIDAELDKLYGAPPFYKVPDLGGLIGHLVVGLA

Expression Region: 287-832aa

Sequence Info: Partial

Source: E.coli

Tag Info: NO-tagged

MW: 59 kDa

Alternative Name(s):

Relevance: Possesses two activities: a DNA synthesis (polymerase) and an exonucleolytic activity that degrades single-stranded DNA in the 3'- to 5'-direction. Has a template-primer preference which is characteristic of a replicative DNA polymerase

Reference: "Genomic analysis of the uncultivated marine crenarchaeote Cenarchaeum symbiosum." Hallam S.J., Konstantinidis K.T., Putnam N., Schleper C., Watanabe Y., Sugahara J., Preston C., de la Torre J., Richardson P.M., DeLong E.F. Proc. Natl. Acad. Sci. U.S.A. 103:18296-18301(2006)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

View full details