Recombinant Cenarchaeum symbiosum DNA polymerase II large subunit(polC) ,partial

Customer Reviews

Be the first to write a review
0%
(0)
0%
(0)
0%
(0)
0%
(0)
0%
(0)

Recombinant Cenarchaeum symbiosum DNA polymerase II large subunit(polC) ,partial

CSB-EP370095DRA
Regular price
€717,95 EUR
Sale price
€717,95 EUR
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.
 More payment options

>Several Other Sizes Are Also Available. Please Inquire. Default Size: 200ug

Updated Date: Stock Protein updated on 20170725

Research areas: others

Target / Protein: polC

Biologically active: Not Tested

Expression system: E.coli

Species of origin: Cenarchaeum symbiosum (strain A)

Delivery time: 3-7 business days

Uniprot ID: A0RYM0

AA Sequence: LAELKGAVQTGENKEDAAAKRMREVITGRSVLSMPNRLGGFRLRYGRACNTGYTSVGFHPAVAEILDHTIAVGTQVKIDIPGKGATVAFVDTIEAPTVRLAGGDVVKIRDVAHGIELKGSIERILHLGDMLISFGDFLENNAQLVPSGYVEEIWKMDMEAAGAAQGSPSSADEAVRISRELGVPLHPRYLYYWDQISHEELAMLLSPLDKGDAISYPAACKPVLEKLGVPHKAGPEGPVLEGDEARIFRELILDNPPGPDASAPVPELISRSSGITIRDKFSTSIGVRIGRPEKAAPRQMRPPTHCLFPVGGTGGPTNNLLKSAARPGFSADILSRRCPGCGEPSISIRCWACGERTAVERTCMQCGTDVDGEECERCGRPGLAHSRVEFPLKKMLVSAQEKTGVRAHDPLKGVKELAHQDRIAEPLEKGLIRQSRSLTVFKDGTVRFDATNSPMTHFKPSWIGTSAEKLRELGYETDVDGKKLEGPDQLVELRMQDIVIPLEGAKYLVSACGYIDAELDKLYGAPPFYKVPDLGGLIGHLVVGLA

Tag info: NO-tagged

Expression Region: 287-832aa

Protein length: Partial

MW: 59 kDa

Alternative Name(s):

Relevance: Possesses two activities: a DNA synthesis (polymerase) and an exonucleolytic activity that degrades single-stranded DNA in the 3'- to 5'-direction. Has a template-primer preference which is characteristic of a replicative DNA polymerase

Reference: "Genomic analysis of the uncultivated marine crenarchaeote Cenarchaeum symbiosum." Hallam S.J., Konstantinidis K.T., Putnam N., Schleper C., Watanabe Y., Sugahara J., Preston C., de la Torre J., Richardson P.M., DeLong E.F. Proc. Natl. Acad. Sci. U.S.A. 103:18296-18301(2006)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

You may also like

  • Recombinant Cenarchaeum symbiosum DNA polymerase II large subunit(polC),partial
    Regular price
    €717,95 EUR
    Sale price
    €717,95 EUR
    Regular price
    Unit price
    per 
    Sold out
  • Recombinant Synechocystis sp.Ribonuclease J(rnj)
    Regular price
    €752,95 EUR
    Sale price
    €752,95 EUR
    Regular price
    Unit price
    per 
    Sold out
  • Recombinant Human DNA-directed DNA-RNA polymerase mu(POLM)
    Regular price
    €516,95 EUR
    Sale price
    €516,95 EUR
    Regular price
    Unit price
    per 
    Sold out
  • Recombinant Human DNA-directed DNA-RNA polymerase mu(POLM)
    Regular price
    €640,95 EUR
    Sale price
    €640,95 EUR
    Regular price
    Unit price
    per 
    Sold out

Your list is ready to share