Skip to product information
1 of 1

Gene Bio Systems

Recombinant Cellvibrio japonicus UPF0060 membrane protein CJA_3703 (CJA_3703)

Recombinant Cellvibrio japonicus UPF0060 membrane protein CJA_3703 (CJA_3703)

SKU:CSB-CF451495DQY

Regular price €1.393,95 EUR
Regular price Sale price €1.393,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Cellvibrio japonicus (strain Ueda107) (Pseudomonas fluorescens subsp. cellulosa)

Uniprot NO.:B3PHW0

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MLKTTLLFVVTALAEIIGCFLPYLWLRKGGSIWLLLPAALSLALFAWLLTLHPTASGRVY AAYGGVYVAVALLWLYWVDGVKLSAYDWAGAAVALLGMAIIAMGWQRS

Protein Names:Recommended name: UPF0060 membrane protein CJA_3703

Gene Names:Ordered Locus Names:CJA_3703

Expression Region:1-108

Sequence Info:full length protein

View full details