Skip to product information
1 of 1

Gene Bio Systems

Recombinant Carica papaya Papain

Recombinant Carica papaya Papain

SKU:CSB-EP365471DQH

Regular price €1.022,95 EUR
Regular price Sale price €1.022,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: Yes

Lead time: 3-7 working days

Research Topic: Allergen

Uniprot ID: P00784

Gene Names: N/A

Organism: Carica papaya (Papaya)

AA Sequence: IPEYVDWRQKGAVTPVKNQGSCGSCWAFSAVVTIEGIIKIRTGNLNEYSEQELLDCDRRSYGCNGGYPWSALQLVAQYGIHYRNTYPYEGVQRYCRSREKGPYAAKTDGVRQVQPYNEGALLYSIANQPVSVVLEAAGKDFQLYRGGIFVGPCGNKVDHAVAAVGYGPNYILIKNSWGTGWGENGYIRIKRGTGNSYGVCGLYTSSFYPVKN

Expression Region: 134-345aa

Sequence Info: Full Length

Source: E.coli

Tag Info: N-terminal 6xHis-tagged

MW: 27.4 kDa

Alternative Name(s): Papaya proteinase I Short name:PPI

Relevance: Catalytic activityi Hydrolysis of proteins with broad specificity for peptide bonds, but preference for an amino acid bearing a large hydrophobic side chain at the P2 position. Does not accept Val in P1'.

Reference: "Structure of papain."Drenth J., Jansonius J.N., Koekoek R., Swen H.M., Wolthers B.G.Nature 218:929-932(1968)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

View full details