Gene Bio Systems
Recombinant Carboxydothermus hydrogenoformans NADH-quinone oxidoreductase subunit A(nuoA)
Recombinant Carboxydothermus hydrogenoformans NADH-quinone oxidoreductase subunit A(nuoA)
SKU:CSB-CF667904CDJ
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Carboxydothermus hydrogenoformans (strain Z-2901 / DSM 6008)
Uniprot NO.:Q3AC77
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MLSPKGAILIFFLTGFFLSIIILVLNYLLSPKSKSLIKRETYECGLETIGPTWVQFKGNY FMYALVFVLFDVETIFLYPWAVRFNVLGLFAFVEMVIFIGILVLGLWYAWKEGALEWK
Protein Names:Recommended name: NADH-quinone oxidoreductase subunit A EC= 1.6.99.5 Alternative name(s): NADH dehydrogenase I subunit A NDH-1 subunit A NUO1
Gene Names:Name:nuoA Ordered Locus Names:CHY_1425
Expression Region:1-118
Sequence Info:full length protein
