Gene Bio Systems
Recombinant Capsicum annuum CASP-like protein PIMP1(PIMP1)
Recombinant Capsicum annuum CASP-like protein PIMP1(PIMP1)
SKU:CSB-CF381757DQD
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Capsicum annuum (Bell pepper)
Uniprot NO.:A1XGB4
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MTPPPTSTVPPYVSLIVRILTLICLLISFIVIATNNQTVSTVAGDVKIKFKDFYAYRYLI ATVIIGMAYTLLQIAFSISLLTTGNRIGGEGFLLFDFYGDKFISYFLVTGAAASFGMTQD LKQLEGSDNYSKFLNTSNAAASLCLIGFFFAVASSIFSSYNLPKRI
Protein Names:Recommended name: CASP-like protein PIMP1 Alternative name(s): Pathogen-induced membrane protein 1 Short name= CaPIMP1
Gene Names:Name:PIMP1
Expression Region:1-166
Sequence Info:full length protein
