Gene Bio Systems
Recombinant Canine coronavirus Non-structural protein 7a(7a)
Recombinant Canine coronavirus Non-structural protein 7a(7a)
SKU:CSB-CF742484CHAH
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Canine coronavirus (strain BGF10) (CCoV) (Canine enteric coronavirus)
Uniprot NO.:Q7T6S7
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:LERLLLNHSLNLKTVNNVLGVTDTGLKVNCLQLLKPDCLDFNILYRSLAETRLLKVVLRV IFLVLLGFCCHRLLVTLF
Protein Names:Recommended name: Non-structural protein 7a Short name= ns7a Alternative name(s): 11 kDa protein Accessory protein 7a X3 protein
Gene Names:ORF Names:7a
Expression Region:24-101
Sequence Info:full length protein
