
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) (Yeast) (Torulopsis glabrata)
Uniprot NO.:P43373
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MLNLLNTLFLNVISNDVPTPYGIYFQDSATPNQEGILELHDNIMFYLFIILGLVSWMLFT IVKTYSKNPMAYKYIKHGQTIEIIWTMFPAVILLIIAFPSFILLYLCDEVISPAMTIKAI GYQWYWKYEYSDFINDNGETIEFESYVIPDDLLEEGQLRLLDTDTSVVVPVDTHIRFVVT GADVIHDFAIPSLGIKVDANPGRLNQVSALIQREGVFYGQCSELCGVNHAAMPIKIEAVS LPKFLEWLNEQ
Protein Names:Recommended name: Cytochrome c oxidase subunit 2 EC= 1.9.3.1 Alternative name(s): Cytochrome c oxidase polypeptide II
Gene Names:Name:COX2
Expression Region:1-251
Sequence Info:full length protein
You may also like
-
Recombinant Candida glabrata Cytochrome c oxidase subunit 3(COX3)
- Regular price
- €1.136,95 EUR
- Sale price
- €1.136,95 EUR
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Candida glabrata Cytochrome c oxidase assembly protein COX16, mitochondrial(COX16)
- Regular price
- €1.004,95 EUR
- Sale price
- €1.004,95 EUR
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Pichia canadensis Cytochrome c oxidase subunit 2(COX2)
- Regular price
- €1.112,95 EUR
- Sale price
- €1.112,95 EUR
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Candida albicans Cytochrome c oxidase subunit 2(COX2)
- Regular price
- €1.131,95 EUR
- Sale price
- €1.131,95 EUR
- Regular price
-
- Unit price
- per
Sold out