Skip to product information
1 of 1

Gene Bio Systems

Recombinant Candida glabrata Cytochrome c oxidase assembly protein COX16, mitochondrial(COX16)

Recombinant Candida glabrata Cytochrome c oxidase assembly protein COX16, mitochondrial(COX16)

SKU:CSB-CF760344CZI

Regular price €1.374,95 EUR
Regular price Sale price €1.374,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) (Yeast) (Torulopsis glabrata)

Uniprot NO.:Q6FW43

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:LSKNPFIFFGLPFCGMMVLGSYWLAGISQVKFDRDDQKVQEMNEEEILKMKHGKREFDIK EEYYRLQGLAEEDWEPKRVERFKGESDNVF

Protein Names:Recommended name: Cytochrome c oxidase assembly protein COX16, mitochondrial

Gene Names:Name:COX16 Ordered Locus Names:CAGL0D03102g

Expression Region:29-118

Sequence Info:full length protein

View full details