Skip to product information
1 of 1

Gene Bio Systems

Recombinant Candida albicans Assembly factor CBP4(CBP4)

Recombinant Candida albicans Assembly factor CBP4(CBP4)

SKU:CSB-CF691383CZD

Regular price €1.426,95 EUR
Regular price Sale price €1.426,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Candida albicans (strain SC5314 / ATCC MYA-2876) (Yeast)

Uniprot NO.:Q59QC6

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MSAVKPLWYRWARVYFAGGCLVGTGVLFWYTIRPTDEQLIARFSPEVKADYERNKELRQQ EQKRLIEIVKETSSSSDPIWKAGPIGSPFEKEQRNLSMELVDAELFHKTKHEEQQKQEID RANEESKEAERLMQQNKKPWWKFF

Protein Names:Recommended name: Assembly factor CBP4 Alternative name(s): Cytochrome b mRNA-processing protein 4

Gene Names:Name:CBP4 ORF Names:CaO19.392, CaO19.8022

Expression Region:1-144

Sequence Info:full length protein

View full details