Skip to product information
1 of 1

Gene Bio Systems

Recombinant Campylobacter jejuni UPF0059 membrane protein CJE0162(CJE0162)

Recombinant Campylobacter jejuni UPF0059 membrane protein CJE0162(CJE0162)

SKU:CSB-CF705407CAAA

Regular price €1.463,95 EUR
Regular price Sale price €1.463,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Campylobacter jejuni (strain RM1221)

Uniprot NO.:Q5HWZ9

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MDFYSLIFLSCALGMDAFAVSLCKGFSVKKLHLKHYLIVGIYFGGFQALMPTIGYFIGIT FASFIASIDHWIAFILLSLIGLKMIKESLENENCDSNANQFGFKTMLALAIATSIDALAV GVSFAFLNVNLLLAIFLIGIITFILCIIALKIGNKFGIYLKNKAELLGGLVLIILGVKIL IEHLFFD

Protein Names:Recommended name: UPF0059 membrane protein CJE0162

Gene Names:Ordered Locus Names:CJE0162

Expression Region:1-187

Sequence Info:full length protein

View full details