
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Caiman crocodilus (Spectacled caiman) (Caiman sclerops)
Uniprot NO.:Q34076
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:GLQLTSPLLTAWWFLACSTNMALPPTINLSGELTLITSLFSWLDITVFLTGLSAFATTTY TLYMFSSTQQGTLPPNIKPSSPSQTREHFLMLLHLLPSAGLATNPKLTAPQ
Protein Names:Recommended name: NADH-ubiquinone oxidoreductase chain 4 EC= 1.6.5.3 Alternative name(s): NADH dehydrogenase subunit 4
Gene Names:Name:MT-ND4 Synonyms:MTND4, NADH4, ND4
Expression Region:1-111
Sequence Info:full length protein
You may also like
-
Recombinant Scyliorhinus canicula NADH-ubiquinone oxidoreductase chain 4L(MT-ND4L)
- Regular price
- €1.012,95 EUR
- Sale price
- €1.012,95 EUR
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Oncorhynchus tschawytscha NADH-ubiquinone oxidoreductase chain 4L(MT-ND4L)
- Regular price
- €1.012,95 EUR
- Sale price
- €1.012,95 EUR
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Procavia capensis NADH-ubiquinone oxidoreductase chain 4L(MT-ND4L)
- Regular price
- €1.012,95 EUR
- Sale price
- €1.012,95 EUR
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Cyprinus carpio NADH-ubiquinone oxidoreductase chain 4L(MT-ND4L)
- Regular price
- €1.012,95 EUR
- Sale price
- €1.012,95 EUR
- Regular price
-
- Unit price
- per
Sold out