Gene Bio Systems
Recombinant Burkholderia xenovorans NADH-quinone oxidoreductase subunit A(nuoA)
Recombinant Burkholderia xenovorans NADH-quinone oxidoreductase subunit A(nuoA)
SKU:CSB-CF618881BNV
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Burkholderia xenovorans (strain LB400)
Uniprot NO.:Q142H3
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MNLAAYFPVLLFLIVGTGLGVALVSIGKILGPNKPDTEKNAPYECGFEAFEDARMKFDVR YYLVAILFIIFDLETAFLFPWGVALRDIGWPGFMAMMIFLLEFLLGFAYIWKKGGLDWE
Protein Names:Recommended name: NADH-quinone oxidoreductase subunit A EC= 1.6.99.5 Alternative name(s): NADH dehydrogenase I subunit A NDH-1 subunit A NUO1
Gene Names:Name:nuoA Ordered Locus Names:Bxeno_A1228 ORF Names:Bxe_A3214
Expression Region:1-119
Sequence Info:full length protein
