Gene Bio Systems
Recombinant Burkholderia pseudomallei UPF0060 membrane protein BPSL1340(BPSL1340)
Recombinant Burkholderia pseudomallei UPF0060 membrane protein BPSL1340(BPSL1340)
SKU:CSB-CF723694BXW
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Burkholderia pseudomallei (strain K96243)
Uniprot NO.:Q63VA1
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MLSLAKIAALFVLTAVAEIVGCYLPWLVLKAGKPAWLLAPAALSLALFAWLLTLHPAAAA RTYAAYGGVYIAVALAWLRIVDGVPLSRWDVAGAALALAGMSVIALQPRG
Protein Names:Recommended name: UPF0060 membrane protein BPSL1340
Gene Names:Ordered Locus Names:BPSL1340
Expression Region:1-110
Sequence Info:full length protein
