Gene Bio Systems
Recombinant Burkholderia phymatum Protein CrcB homolog(crcB)
Recombinant Burkholderia phymatum Protein CrcB homolog(crcB)
SKU:CSB-CF464187BXT
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Burkholderia phymatum (strain DSM 17167 / STM815)
Uniprot NO.:B2JCE3
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MYLSILAVGIGGALGSLFRWFLGLRLNALFPALPLGTLASNVIAGYIIGAAVAYFGRNPQ IAPEWRLFIITGLMGGLSTFSTFSAEVVQHLQQGRLNWAAGEIAIHVTASVIATVLGITT VAVVTR
Protein Names:Recommended name: Protein CrcB homolog
Gene Names:Name:crcB Ordered Locus Names:Bphy_1762
Expression Region:1-126
Sequence Info:full length protein
