Recombinant Burkholderia cenocepacia  NADH-quinone oxidoreductase subunit A(nuoA)

Recombinant Burkholderia cenocepacia NADH-quinone oxidoreductase subunit A(nuoA)

CSB-CF370212BPO
Regular price
€1.008,95 EUR
Sale price
€1.008,95 EUR
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Burkholderia cenocepacia (strain HI2424)

Uniprot NO.:A0K923

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MNLAAYYPVLLFLLVGTGLGIALVSIGKLLGPNKPDVEKNAPYECGFEAFEDARMKFDVR YYLVAILFIIFDLETAFLFPWGVALRDIGWPGFIAMMIFLLEFLLGFAYIWKKGGLDWE

Protein Names:Recommended name: NADH-quinone oxidoreductase subunit A EC= 1.6.99.5 Alternative name(s): NADH dehydrogenase I subunit A NDH-1 subunit A NUO1

Gene Names:Name:nuoA Ordered Locus Names:Bcen2424_2249

Expression Region:1-119

Sequence Info:full length protein

Your list is ready to share