Skip to product information
1 of 1

Gene Bio Systems

Recombinant Buchnera aphidicola subsp. Schizaphis graminum Protein-export membrane protein SecG(secG)

Recombinant Buchnera aphidicola subsp. Schizaphis graminum Protein-export membrane protein SecG(secG)

SKU:CSB-CF817037BXE

Regular price €1.389,95 EUR
Regular price Sale price €1.389,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)

Uniprot NO.:Q8K9G9

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MYLFFLIFLIFISFSLIFLILLQSGKGFNNTIHLNTSNNFNFFNSVGSGGFIKNIIGFFA GFFLIFSIILCNINDKKVNSDVFLEKNTQKKTINEKKEQKILNSELPL

Protein Names:Recommended name: Protein-export membrane protein SecG

Gene Names:Name:secG Ordered Locus Names:BUsg_367

Expression Region:1-108

Sequence Info:full length protein

View full details