Skip to product information
1 of 1

Gene Bio Systems

Recombinant Buchnera aphidicola subsp. Acyrthosiphon pisum Protein-export membrane protein SecG(secG)

Recombinant Buchnera aphidicola subsp. Acyrthosiphon pisum Protein-export membrane protein SecG(secG)

SKU:CSB-CF347941BWZ

Regular price €1.383,95 EUR
Regular price Sale price €1.383,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) (Acyrthosiphon pisum symbiotic bacterium)

Uniprot NO.:P57460

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MYLFFLIVFIFISFSLIFFILLQPGKGLNNTVHSHTKNNIKFFNSIGTNNFITKIIKILA FFFLLISIILCNINSKRIDSDFFWEDNQNNTITKKHVLDKKKLNLDIPN

Protein Names:Recommended name: Protein-export membrane protein SecG

Gene Names:Name:secG Ordered Locus Names:BU380

Expression Region:1-109

Sequence Info:full length protein

View full details