Gene Bio Systems
Recombinant Buchnera aphidicola subsp. Acyrthosiphon pisum Cytochrome o ubiquinol oxidase subunit 3(cyoC)
Recombinant Buchnera aphidicola subsp. Acyrthosiphon pisum Cytochrome o ubiquinol oxidase subunit 3(cyoC)
SKU:CSB-CF347950BWZ
Couldn't load pickup availability
Size:50 ug. Other sizes are also available.
Product Type:Recombinant Protein
Species:Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) (Acyrthosiphon pisum symbiotic bacterium)
Uniprot NO.:P57542
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MIENKFNNTILNSNSSTHDKISETKKLFGLWIYLMSDCIMFAVLFAVYAIVSSNISINLI SNKIFNLSSILLETFLLLLSSLSCGFVVIAMNQKRIKMIYSFLTITFIFGLIFLLMEVHE FYELIIENFGPDKNAFFSIFFTLVATHGVHIFFGLILILSILYQIKKLGLTNSIRTRILC FSVFWHFLDIIWICVFTFVYLNGAI
Protein Names:Recommended name: Cytochrome o ubiquinol oxidase subunit 3 EC= 1.10.3.- Alternative name(s): Cytochrome o ubiquinol oxidase subunit III
Gene Names:Name:cyoC Ordered Locus Names:BU470
Expression Region:1-205
Sequence Info:full length protein
