Skip to product information
1 of 1

Gene Bio Systems

Recombinant Brucella suis Probable intracellular septation protein A (BSUIS_A1775)

Recombinant Brucella suis Probable intracellular septation protein A (BSUIS_A1775)

SKU:CSB-CF538310BWU

Regular price €1.507,95 EUR
Regular price Sale price €1.507,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Brucella suis (strain ATCC 23445 / NCTC 10510)

Uniprot NO.:B0CIT9

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MEHPVFERDPSEKSETERREVPPLLKLALELGPLLVFFFANARGEMLIERFPILGSIGAP IFLATALFMAATVIALAISWSMTRTLPIMPLVSGIVVLVFGALTLWLHNDTFIKMKPTIV NTLFGGILLGGLFFGKSLLGYVFDSAFRLDAEGWRKLTLRWGLFFIFLAIVNEIVWRNFS TDTWVSFKVWGIMPITIVFTLLQMPLIQKHSLTDEENTAS

Protein Names:Recommended name: Probable intracellular septation protein A

Gene Names:Ordered Locus Names:BSUIS_A1775

Expression Region:1-220

Sequence Info:full length protein

View full details