Skip to product information
1 of 1

Gene Bio Systems

Recombinant Brucella suis biovar 1 Type IV secretion system protein virB2(virB2)

Recombinant Brucella suis biovar 1 Type IV secretion system protein virB2(virB2)

SKU:CSB-CF765865BMQ

Regular price €1.343,95 EUR
Regular price Sale price €1.343,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Brucella suis biovar 1 (strain 1330)

Uniprot NO.:Q7CEG0

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:NGGLDKVNTSMQKVLDLLSGVSITIVTIAIIWSGYKMAFRHARFMDVVPVLGGALVVGAA AEIASYLLR

Protein Names:Recommended name: Type IV secretion system protein virB2

Gene Names:Name:virB2 Ordered Locus Names:BRA0068, BS1330_II0068

Expression Region:37-105

Sequence Info:full length protein

View full details