Gene Bio Systems
Recombinant Brucella melitensis biotype 1 Lipoprotein signal peptidase(lspA)
Recombinant Brucella melitensis biotype 1 Lipoprotein signal peptidase(lspA)
SKU:CSB-CF849153BMO
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094)
Uniprot NO.:Q8YES8
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MKRHAVWSSLFVVILAVLIDQGIKYLVESRMFYGQQIDLLPFLALFRTHNEGIAFSMLAW LHDGGLIAITLAVIAFVLYLWWTNAPERVFARYGFALVIGGAIGNLIDRVMHGYVVDYVL FHLPTWSFAVFNLADAFITIGAGLIILEEFLGWRRERISH
Protein Names:Recommended name: Lipoprotein signal peptidase EC= 3.4.23.36 Alternative name(s): Prolipoprotein signal peptidase Signal peptidase II Short name= SPase II
Gene Names:Name:lspA Ordered Locus Names:BMEI1799
Expression Region:1-160
Sequence Info:full length protein
