Skip to product information
1 of 1

Gene Bio Systems

Recombinant Brucella canis Lectin-like protein BA14k (BCAN_B0743)

Recombinant Brucella canis Lectin-like protein BA14k (BCAN_B0743)

SKU:CSB-CF432978BPH

Regular price €1.403,95 EUR
Regular price Sale price €1.403,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Brucella canis (strain ATCC 23365 / NCTC 10854)

Uniprot NO.:A9MC22

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:APMNMDRPAINQNVIQARAHYRPQNYNRGHRPGYWHGHRGYRHYRHGYRRHNDGWWYPLA AFGAGAIIGGAISQPRPVYRAPAGSPHVQWCYSRYKSYRASDNTFQPYNGPRKQCRSPYS R

Protein Names:Recommended name: Lectin-like protein BA14k

Gene Names:Ordered Locus Names:BCAN_B0743

Expression Region:27-147

Sequence Info:full length protein

View full details