Skip to product information
1 of 1

Gene Bio Systems

Recombinant Brucella abortus Type IV secretion system protein virB3(virB3)

Recombinant Brucella abortus Type IV secretion system protein virB3(virB3)

SKU:CSB-CF648998BMN

Regular price €1.431,95 EUR
Regular price Sale price €1.431,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Brucella abortus (strain 2308)

Uniprot NO.:Q2YIT7

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MTTAPQESNARSAGYRGDPIFKGCTRPAMLFGVPVIPLVIVGGSIVLLSVWISMFILPLI VPIVLVMRQITQTDDQMFRLLGLKAQFRLIHFNRTGRFWRASAYSPIAFTKRKRES

Protein Names:Recommended name: Type IV secretion system protein virB3

Gene Names:Name:virB3 Ordered Locus Names:BAB2_0066

Expression Region:1-116

Sequence Info:full length protein

View full details