Gene Bio Systems
Recombinant Brevibacillus brevis UPF0756 membrane protein BBR47_23170 (BBR47_23170)
Recombinant Brevibacillus brevis UPF0756 membrane protein BBR47_23170 (BBR47_23170)
SKU:CSB-CF505935BWL
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Brevibacillus brevis (strain 47 / JCM 6285 / NBRC 100599)
Uniprot NO.:C0ZBY5
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MMSGEVMLVILIVIGLIGRSPIIATAASILLVLKLTALERFFPTVERRGLELGLLFLTIS VLVPFASEKISWKDVTPLFTTVVGLTALAGGAIATWMNGKGLDLLRSEPHMIVGLVIGSI IGIVFFRGIPVGPLMAAGITAFVLKLWEWFGSR
Protein Names:Recommended name: UPF0756 membrane protein BBR47_23170
Gene Names:Ordered Locus Names:BBR47_23170
Expression Region:1-153
Sequence Info:full length protein
