Gene Bio Systems
Recombinant Bovine Tumor necrosis factor receptor superfamily member 1A(TNFRSF1A)
Recombinant Bovine Tumor necrosis factor receptor superfamily member 1A(TNFRSF1A)
SKU:CSB-CF023977BO
Couldn't load pickup availability
Size:50 ug. Other sizes are also available.
Product Type:Recombinant Protein
Species:Bos taurus (Bovine)
Uniprot NO.:O19131
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:VYPAGVQGLVPHPGDLEKRESPCPQGKYNHPQNSTICCTKCHKGTYLYNDCPGPGRDTDCRVCAPGTYTALENHLRRCLSCSRCRDEMFQVEISPCVVDRDTVCGCRKNQYREYWGETGFRCLNCSLCPNGTVNIPCQERQDTICHCHMGFFLKGAKCISCHDCKNKECEKLCPTRPSTGKDSQDPGTTVLLPLVIVFGLCLASFASVVLACRYQRWKPKLYSIICGQSTLVKEGEPELLVPAPGFNPTTTICFSSTPSSSPVSIPPYISCDRSNFGAVASPSSETAPPHLKAGPILPGPPASTHLCTPGPPASTHLCTPGPPASTHLCTPVQKWEASAPSAPDQLADADPATLYAVVDGVPPSRWKELVRRLGLSEHEIERLELENGRHLREAQYSMLAAWRRRTPRREATLELLGRVLRDMDLLGCLENIEEALGGAARLASEPRLLW
Protein Names:Recommended name: Tumor necrosis factor receptor superfamily member 1A Alternative name(s): Tumor necrosis factor receptor 1 Short name= TNF-R1 Tumor necrosis factor receptor type I Short name= TNF-RI Short name= TNFR-I p55 p60 CD_antigen= CD120a
Gene Names:Name:TNFRSF1A Synonyms:TNFR1
Expression Region:22-471
Sequence Info:full length protein
