Skip to product information
1 of 1

Gene Bio Systems

Recombinant Bovine Transmembrane protein 11, mitochondrial(TMEM11)

Recombinant Bovine Transmembrane protein 11, mitochondrial(TMEM11)

SKU:CSB-CF023679BO

Regular price €1.475,95 EUR
Regular price Sale price €1.475,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Bos taurus (Bovine)

Uniprot NO.:A5D7N3

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MAAWGRRRLGPGSGGGGARERVSLSATDCYIVHEIYNGENAQDQFEYELEQALEAQYKYI VIEPTRIGDETARWITVGNCLHKTTVLAGTACLFTPLALPLDYSHYISLPAGVLSLACCT LYGISWQFDPCCKYQVEYDAYRLSRLPLHTLTSSTPVVLVRKDDLHRKRLHNTIALAALV YCVKKIYELCAV

Protein Names:Recommended name: Transmembrane protein 11, mitochondrial

Gene Names:Name:TMEM11

Expression Region:1-192

Sequence Info:Full length protein

View full details