Recombinant Bovine Succinate dehydrogenase [ubiquinone] cytochrome b small subunit, mitochondrial(SDHD)

SKU: CSB-CF856763BO

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Bos taurus (Bovine)

Uniprot NO.:Q95123

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:SGSKAASLHWTGERVVSVLLLGLIPAAYLNPCSAMDYSLAATLTLHSHWGIGQVVTDYVH GDAVQKAAKTGLLVLSAFTFAGLCYFNYHDVGICKAVAMLWKL

Protein Names:Recommended name: Succinate dehydrogenase [ubiquinone] cytochrome b small subunit, mitochondrial Short name= CybS Alternative name(s): CII-4 QPs3 Succinate dehydrogenase complex subunit D Succinate-ubiquinone reductase membrane

Gene Names:Name:SDHD Synonyms:SDH4

Expression Region:56-158

Sequence Info:full length protein