Recombinant Bovine Serine palmitoyltransferase small subunit B(SPTSSB)

SKU: CSB-CF605193BO

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Bos taurus (Bovine)

Uniprot NO.:Q0IIK4

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MDFKRVKDYLSWLYYQYQIISCCAVLEPWEQSMFNTIILTIFAMVVYTAYVFIPIHIRLA WEFFSKMCGYHSTISN

Protein Names:Recommended name: Serine palmitoyltransferase small subunit B Alternative name(s): Protein ADMP Small subunit of serine palmitoyltransferase B Short name= ssSPTb

Gene Names:Name:SPTSSB Synonyms:ADMP, SSSPTB

Expression Region:1-76

Sequence Info:full length protein